- Recombinant Saccharomyces cerevisiae UPF0041 protein FMP37 (FMP37)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1134904
- UPF0041 protein FMP37 (FMP37)
- MPC1
- 1-130
- E Coli or Yeast
- 14,995 Da
- Recombinant Protein
- >90%
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- 1 mg (E Coli Derived)
Sequence
MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKEWKEKEKTGKQ